Internet Job Sites

10. Networking, Mentoring, & Q&A Sites

CyberFiber® Newsgroups Directory and Search

Your Recommended Allowance of Net News™
1

Job Newsgroup for Job Opportunity, Descriptions, Computer Job Openings, Recruiters, and Career Planning at JobBankUSA.com

Jobs Usenet Newsgroups2

Usenet Info Center Launch Pad

Usenet Info Center Launch Pad3

Monster: Message Boards

Monster Message Boards

Welcome to the Monster message boards. Our experts answer posts approximately twice a week. Feel free to ask questions, share your stories and network with your peers.

4

Vault: Message Boards

Welcome to the Electronic Watercooler™ – the original online workplace and career community.
We have 846,886 messages to read.
5

A Better Job Fast! - myjobsearch.com

 

 
The myjobsearch.com free monthly newsletter.
Sign up now!
 
Effective networking is much more than asking people you know about job opportunities. To be successful, you need to get to know more people. The following resources will help you meet people in your field and network with them successfully.
6

WetFeet.com > Managing Your Career > Networking

Networking7

Monster: career management: Networking

Networking
8

Quintessential Careers: The Art of Networking

The Art of Networking9

SchmoozeMonger.com the Networking and Schmoozing Uberportal

Subscribe to the Schmoozeletter! Send a blank email to mailto:schmoozemonger-subscribe@yahoogroups.com .10

Business Networking Articles by Susan RoAne

Business Networking, Conversation, and Mingling Articles

11

Contacts Count - Working Know-How for Business and Career Success

Want lots of useful tips on networking and career futuring?

12

Amazon.com: Books: America's Top Internet Job Sites: The Click and Easy Guide to Finding a Job Online (Click & Easy Series)

America's Top Internet Job Sites: The Click and Easy Guide to Finding a Job Online (Click & Easy Series)
by Ron Krannich, Caryl R. Krannich, Ronald L. Krannich

c2002

November 25, 2002

Chapter 1
4. being effective and staying focused
7. - assessment; research; networking; resume & letters; interview; salary negotiation

Chapter2: Getting Started & Staying Focused
11. using time wisely
13. N.B. roughguides.com ...
14. goettem.com
15. cf: search engines; search agents; directories
39. Bolles, Margaret F. Dikel; Randall Hanson
59. advocates redundancy ...
61. hoovers.com & wetfeet.com; monster owns -> hotjobs.com; jobtrack
63. jobs.com reference checker
69. vault.com
89. self directed search
107. Harcourt <- Thomson Learning
108. Brainbench
124. declining companies13

1. The World of Internet Job Sites

2: Getting Started and Staying Focused

Top9.com

http://www.top9.com/

Top9.com is the Internet's first Search Directory to use consumer intelligence to comprehensively rank the most popular websites by industry category on a monthly basis. Top9.com will change how consumers look for information and products on the Internet - no more wading through useless clutter and broken links. And its simple design will allow consumers to easily surf using PCs, hand-held devices, and WebTV. Top9.com is more than just another online search directory - it is a tool to empower consumers to make smart decisions.

Top9.com is a new business venture of Omega World Travel, which has signed a five-year agreement with PC Data Online for exclusive rights to consumer research intelligence for Top9.com. PC Data Online surveys "unique users" from a panel of over 120,000 real-time home users of the Internet - the largest domestic home panel of any Internet measurement firm. Because of the size of the survey pool, and the independent methodology used by PC Data Online, Top9.com's rankings are based on the most reliable Internet consumer research data available today.

14

Ranks.com - Top Job Search Sites

Ranks.com : Lifestyle : Top Job Search Sites (60)

Ranks.com is a simple, effective upgrade from current search engines. The easy difference is that our directory queries only the best destinations available for your search, within categories that matter most. By using experienced human judgment each link is the best in its field, guaranteed by our staff of specialized directory editors.15

100Hot

100hottest jobs sites16

3: Virtual Job and Career Communities

Google

Google 17

CyberFiber® Newsgroups Directory and Search

LC&D Internet Publishing is pleased to present CyberFiber® Newsgroups,
the most comprehensive directory to USENET and alt. Newsgroups.
18

Job Bank USA

JobBankUSA.com19

Topica

Topica 20

4: Gateway Employment Sites

Quintessential Careers Site Award: myjobsearch.com

myjobsearch.com21

AIRS

AIRS22

CAREERXROADS - the leading guide to job and resume sites on the Web

CareerXroads 23

Quintessential Careers: College, Careers, and Jobs Guide

Quintessential Careers 24

The Riley Guide: Employment Opportunities and Job Resources on the Internet

The Riley Guide25

JobHuntersBible.com: Job Hunting Online with Richard Bolles and What Color Is Your Parachute

JobHuntersBible 26

Job-Hunt.Org, Award-Winning Jobs and Job Search Super-List, Careers, Employment, Job Site Directory

The Super-List of the Web's best Careers, Jobs, and Job Search Sites.
27

Career Resource Homepage

The sites containing career related resources have been categorized as follows: 28

Jobweb - The Catapult

Jobweb's Catapult, the springboard to career- and job-related sites, will soon disappear from our site. The information, however, has been added into the new JobWeb structure. We have kept the original table contents on our site to help you find the information you are seeking. If you refer to one of the pages below frequently, please delete your existing bookmark, and create a new one today. 29

Jobs, Careers, Employment, Education, Business Links - Careers.Org

Careers.Org
IF IT'S ABOUT YOUR CAREER ... IT'S HERE !!!
30

JobSourceNetwork-The Internet's Mega Job Site!

We at the Job Source Network have helped thousands with their job search -
and we want to help you.

31

University of London Careers Service

[University of London Careers Service Home] 32

JobBoard.net

We have searched the Internet for Job Boards and Resume Banks and brought all these links together at one convenient location!

33

MegaJobSites.com : Job Search

MegaJobSites® The largest community of job sites online.
Please visit the niche site that best matches you and your profession!
34

5: Mega Employment Sites and Databases

Monster

Monster 35

America's Job Bank - job search engine - Jobs

Welcome to America's Job Bank!
Visit our site and see how we can help you find the job that's right for you. Thousands of new jobs are posted daily by employers searching for someone like you.
36

FlipDog.com

FlipDog.com 37

JobsOnline

As one of the leading employment websites on the internet today, JobsOnline provides job seekers with extensive job listings and the most useful career resources to begin a successful job search. Thousands of jobs, resume and cover letter samples, expert career advice, and a handy salary calculator are just a few offerings that are free to those seeking a new job.

38

HotJobs.com

HotJobs 39

careerbuilder.com

CareerBuilder 40

Headhunter.net (Careerbuilder.com?)

CareerBuilder 41

Jobs.com
Whether you're just starting your career or looking to strengthen your lead in the business world, these sites offer the most comprehensive career resources available on the Web.

Go find the job that's right for you from over 1 million job listings or post your resume and let the world's top employers come discover you. 42

JobOptions -Job Database, Private Resume Builder and Recruitment Resource

Job Options is pleased to introduce Spherion. Serving as your personal recruiter, Spherion can help you identify companies that meet your criteria, and is seeking qualified candidates with your skills.43

Career.com

CAREER.COM P.O. Box 3536, Los Altos, CA 94024-3536
Voice: 650.851.1580 Fax: 650.851.7340
E-Mail:info@career.com
44

MSN Search: www.myjobsearch.com -- More Useful Everyday

We can't find "www.myjobsearch.com".

45

employMAX employ jobs resumes

Job Seeker
46

NationJob

Job Seekers
Search Jobs & Sign Up P.J. Scout
Search Companies
Access Your P.J. Scout Account
Post Your Resume with P.J. Scout
47

EmploymentGuide.com

Search or browse jobs in your city
or across the nation48

CareerJournal.com -- The premier executive career site from The Wall Street Journal
Employment 911 - Job Search, Resume Posting, Job Posting, Career & Employment Advice and Human Resources Tools

Why spend hours going from one job site to another?
You can use Employment 911 to search over 100 major job sites and 3 million jobs in only one click. Our job search covers more job sites at one time than anyone else. 50

EmploymentSpot.com: Job search, careers, jobs, employment, resumes & more.

© 1998-2002, StartSpot Mediaworks, Inc.
Advertising Information | Privacy Policy | Contact Us
51

JobFactory.com - Search millions of jobs, plus locate career information, joblines, and recruiters...



A Summary of What You Will Find   The JobFactory provides online help for the jobseeker in the following areas...

52

Vault: the insider career network

"Vault" is a registered servicemark and "Vault.com", the "Vault.com logo", "Electronic Watercooler", "The Workplace Network", "Am I Worthy", "Tools for Work", "VaultMatch", "The HR Guy", "The Insider Career Network", and "Career Advancement for Professionals" are trademarks and/or service marks of Vault.com Inc. All other products, company names or logos are trademarks and/or service marks of their respective owners.53

WetFeet.com > Helping You Make Smarter Career Decisions

Even more updated insider information to help you land the job.
54

Net-Temps - The Leading Website for Contract, Temporary and Permanent Employment

Copyright 2002, Net-Temps, Inc. All Rights Reserved. Net-Temps ® is a registered trademark.55

4Work Home Page

Job Alert! is a confidential job search agent that screens thousands of jobs to find situations suited to you. Get results in two minutes with fresh updates emailed daily! Login or sign up today...It's free! 56

BestJobsUSA.com - For your job and your career

BestJobsUSA.com
550 Heritage Drive, Suite 200
Jupiter, FL 33458
Phone - 561.686.6800 | Fax - 561.686.8043
rci@bestjobsusa.com57

BrilliantPeople.com - The Jobs. The Recruiters. The Good Life.

Copyright © 1999 - 2001 Management Recruiters International, Inc.
ALL RIGHTS RESERVED
58

CareerShop_Home

   Screen resumes and post jobs with your online career center and hiring system.
   Click here to find out more!

59

MSN Search: www.jobsleuth.com -- More Useful Everyday

We can't find "www.jobsleuth.com".60

TrueCareers.com (Career City)

Sweepstakes | Privacy | Terms of Use | About TrueCareers, Inc. | Posting Jobs
©2001-2002 TrueCareers Inc. All rights reserved. | 1.800.441.406261

JobWeb.com - The online complement to NACE's Job Choices publications.

Every week JobWeb’s editorial team scours the headlines to find what matters most to college students and new grads—and we put it right here!62

monsterTRAK

Avoid weeding yourself out of a job match. Write clear, clean resumes and letters. 63

JobOpps.net

Cannot connect.

BrassRing.com: IT and high tech job search & HR software

BrassRing.com is the job search site for finding IT jobs, tech jobs, Internet jobs, and job fair information. Using BrassRing's job database, candidates can post resumes to high tech employers and find employment opportunities.
64

Job Bank USA

Welcome to JobBankUSA.com! 65

CareerTV.net - It All Starts Here

© 2000 CareerTV.net, Inc. All rights reserved.
Questions or comments? Send mail to webmaster@careertv.net
66

Jumbo Classified Careers -- Jobs, Careers, Resumes, Employment and More!

Consultants:
Jumbo Classifieds Networking has more than 70,000 computer related brand name low cost items. All shipping is FREE! This includes NEXT-DAY delivery. Please be sure to stop by Jumbo Classifieds Networking for all your computer needs. 67

Preferred Jobs - Computer Jobs - Atlanta Denver Florida Chicago Boston California

© 1997 American Preferred Jobs Inc., All Rights Reserved. Legal & Privacy Notices 68

ProHire | The Leader in Online Job Searching and Recruiting Solutions has Jobs and Employment for Professionals - Resume Banks, Employment Resources, Job Placement

powered by Recruitmax Software | the leader in online recruiting solutions 69

CareerExchange.com | Thousands of jobs!

Let CareerExchange.com email you matching jobs!70

CareerMag Career Center

Get started right now by creating your Free account and take advantage of all the tools that come with it. You can post your resume, build your portfolio, turn it into a personal website all in a matter of minutes. Search jobs and submit your resume directly to the companies that interest you. Take a few moments and create your Free account now!
71

EmployersOnline - Jobs - $45K to well over 6 Figures

Search our job database for job opportunities! 72

Wanted Jobs - United States

Copyright © 2002, Wanted Technologies Inc. All Rights Reserved.73

mindfind.com - Looking for something?

Welcome to mindfind.com. We've collected a list of resource sites to help you find exactly what you're looking for. Find what you're looking for below or use the search box on the left. Thanks for visiting and we hope you we've made your internet experience a little better.74

Employment Wizard (JobExchange)

Will Your Résumé Pass the 30-Second Test?     Did you know that most recruiters make a decision on your
résumé in only 30 seconds! Let an expert give you an edge!
75

RecruitUSA: Recruitment Optimization

Is there anybody out there?

Yes. And they're looking for you right now.

Launch your career search by accessing thousands of jobs, and add your resume to our resume database.

76

JobDirect (TrueCareers.com)

Sweepstakes | Privacy | Terms of Use | About TrueCareers, Inc. | Posting Jobs
©2001-2002 TrueCareers Inc. All rights reserved. | 1.800.441.406277

Other major sites

1-jobs.com: BrassRing.com: IT and high tech job search & HR software

BrassRing.com is the job search site for finding IT jobs, tech jobs, Internet jobs, and job fair information. Using BrassRing's job database, candidates can post resumes to high tech employers and find employment opportunities78

6FigureJobs - the leading site for executive job seekers, employers and executive recruiters

Search through over 4.5 million job postings from over 6,000 sites across the Web.79

Advance Careers: Best Local Jobs

Best Local Jobs Is A
Service of Advance Internet

80

CampusCareerCenter.com - Entry-Level Jobs & Internships for College Students

CampusCareerCenter.com – Entry-Level Jobs & Internships for College Students © 2002 All Rights Reserved. 81

CareerMarketplace.com Engineering, IT, Marketing and Related Job Sites

N.B. Has many field related web sites

 

© 2002 Critical Mass Systems. Critical Mass Systems, www.CareerMarketplace.com and other listed domain names are trademarks of Critical Mass Systems. 82

CareerSite.com - Post your resume and find great jobs! FREE TRIAL-for employers!

Copyright © 2002 CareerSite Corporation. All rights reserved. 83

Classifieds2000.com - The Ultimate Guide

Formerly Excite Classifieds
84

College Recruiter: Jobs Internships Work Entry Level Careers Students Search Resume Bank Database

Copyright © 1996-2002. All rights reserved.
Adguide Publications, Inc. - 3722 W 50 St Ste 121 - Minneapolis, MN 55410-2016
(800) 835-4989 | (952) 848-2211 | Fax: (952) 915-1102 | Email
85

ComputerJobs.com - Computer Job Search for IT Pros

Copyright 1995-2002 © ComputerJobs.com, Inc. All Rights Reserved.
ComputerJobs.com is a registered trademark of ComputerJobs.com, Inc.
86

craigslist: san francisco bay area online community

craigslist
87

Dice.com

4101 NW Urbandale Drive, Urbandale, IA 50322
Toll Free Phone: 877.386.3323 | Fax: 515.280.1452 | Local: 515.280.1144
88

Employment Wizard

Will Your Résumé Pass the 30-Second Test?     Did you know that most recruiters make a decision on your
résumé in only 30 seconds! Let an expert give you an ed
89

ExecuNet - The Center for Executive Careers

What sets us apart?

We're a unique executive community. The premier interactive network and membership organization for the $100,000+ executive. We focus exclusively on the job search and career advancement needs of our members and those seeking top executive talent.
90

Experience.com

Copyright ©2002 Experience.com, Inc., One Faneuil Hall Marketplace, Boston, MA 0210991

Free Community

Not informative site at all.  All it does is one giant mailto page.92

GotAJob.com is your complete job hunting resource site. Part time, full time, anytime!

GotAJob.com is your place whether you've already "Got-A-Job" or you're just starting your job search. If you are looking for a part-time job, visit our partner site, SnagAJob.com, where you'll find thousands of part-time jobs from some of the most well-known companies around the country.
93

HireAbility.com - Home

Copyright © 1997-2002 HireAbility.com, LLC     Phone 603.890.1099 94

Hirestrategy.com - Connecting Talented People with Great Places to Work

Security clearances have always been resume gems in Washington, but with the expected boom in homeland security jobs, a clearance has become as highly prized as a taxi medallion in Manhattan. 95

ITcareers

Despite the tough economy, keeping prized IT workers satisfied is still a top priority at companies in the U.S. and around the world. The best employers know how to do more with less while keeping their IT staffs content and challenged96

JobCircle.com: A regional tool that provides Careers, Content, and Community for technology professionals!

JobCircle.com is an award-winning employment and information tool for Technology professionals in Boston and surrounding areas. JobCircle.com provides thousands of regional employment opportunities, resume submission, career development, monthly columns, discussion databases, tech news, regional career events, and much, much more to a community of over 72,287 technology, telecom, engineering, and security-cleared professionals!  Read what people are saying about JobCircle.com! 97

Jobnet.com Philadelphia's Career Site

No time to search for a job? Jobnet understands. We can do it for you! Hire our Job Butler and he¹ll email the right jobs to you every week. The best part is that it's free!
98

JobStar: Job Search Guide

"How To" Information for Job Seekers Everywhere: Resumes, Career & Salary Info, Hidden Job Market. 99

800-241-5642 - NETSHARE.COM - Your source for executive jobs

Copyright © 2002 • NETSHARE.com • All rights reserved100

washingtonpost.com: Jobs

©Copyright 2002   The Washington Post Company
101

Welcome to / Bienvenue sur workopolis.com

102

6: Assessment and Testing Sites

MAPP- Brought to you by Assessment.com

MAPP reveals the real you
Your Assessment reveals your natural motivations and talent for work. When your job matches your true motivations work seems easier and is more fulfilling. 103

careerhub.org - Welcome

Careers
Work At Home, MBA, MCSE, Nursing, Education, Business Schools, Management Training, Online Training, Graduate Schools, Start A Business 104

Keirsey Temperament and Character Web Site

The Web Site for the Keirsey Temperament Sorter and Keirsey Temperament Theory
105

Personality Type Welcome - book headquarters for Do What You Are - Nurture By Nature - Just Your Type - The Art of Speedreading People

We're the authors of four best selling books about Personality Type -- a powerful tool that will make you happier and more successful in every aspect of your life. This site is all about YOU -- your career, your family, your children, your relationships! Knowing your "type" unlocks powerful insights that help you understand yourself and others as never before. 106

Personality Online - Online personality, relationship and apptitude tests, find out who you are today!

Welcome to Personality Online, your one stop resource for self discovery and personal development. Here you will find everything from a variety of personality tests to a comprehensive database of personal development related resources. 107

Welcome to the Self-Directed Search...the world's most widely used career interest inventory!

108

The Princeton Review Career Quiz

The Princeton Review Career Quiz

Think of how happy you'd be to go to work each day saying to yourself, "I want to," not "I have to." The difference? It's simply matching the right person with the right place. For most people achieving that perfect fit isn't that simple.

109

Analyze My Career: Aptitude tests, Personality test, Career Guidance, Employment data, Entrepreneur test

Copyright 2001 AnalyzeMyCareer.com. All rights reserved.
8345 NW 66th Street #3689, Miami, FL 33166-2626.   Voice/Fax: (305) 418-7402
110

Assessment MBTI Career Chart - U.S. DOI

Connecting Personality Types With
Careers and Jobs

111

CareerPerfect® premier résumé writing, online career planning, interviewing, testing ... and more!

- Career planning and testing for career success112

Personality and IQ Tests

Personality Tests 113

QueenDom.com: Tests, Tests, Tests: The world’s biggest testing center with personality, intelligence, relationship, career and health tests.

Tests Tests Tests
Are you worried about your ability to concentrate? Is your failure to focus on important tasks interfering with the achievement of your goals? Take Queendom’s new
Attention Test to find out just how much this is impacting on your life.
114

IQ tests & Personality tests

Personality tests, iq tests and entrepreneur tests online 115

Fortune.com - Careers

Holiday Job Hunting
Contrary to the conventional wisdom, November and December may actually be the best months to land a new position. Here's how to make the most of the season, career-wise. 116

Profiler: Your Expert in Internet Data Collection

Welcome to profiler.com. You can use this Internet site to collect data for a multitude of purposes. Some of the more popular applications are assessments/tests, satisfaction and demographic surveys, enrollment applications, product registration, and data and report distribution. We can develop electronic documents as elaborately as required including multimedia and data editing/verification. If you don't have a corporate Internet presence, want to outsource a project, or want to remain anonymous, profiler.com can be your solution.
117

CareerLab: 700-page career, outplacement, & HR megasite

We're a career strategy and leadership development firm based in Denver, Colorado USA. "We help people with their careers, and we help companies with their people."(sm) Since 1978, more than 275 brand-name corporations, both large and small, have hired us to guide them safely and effectively through major organizational change. At the same time, we've orchestrated remarkable career advancement for mid-to senior-level managers and executives, top professionals, consultants, and entrepreneurs. This page is updated for Thursday, December 12, 2002. Translate this site into your native language. 118

College Board: College Planning and Career Planning from MyRoad.com

©2002 by collegeboard.com Inc. and its licensors. All rights reserved.119

CareerLeader: Guided Tour

Welcome to the Guided Tour of the most respected and comprehensive business career development tool -- CareerLeader®. This program is a fully integrated approach to business career self-assessment developed by Dr. Timothy Butler, Director of MBA Career Development Programs at the Harvard Business School, and Dr. James Waldroop, Dr. Butler's associate at HBS for 18 years. This interactive, online program is currently being used by over 150 top business and MBA programs in the US and Europe to help guide their students, as well as by numerous corporations to help retain their employees.
120

Careers By Design Career Assessments

Careers By Design® is a professional career development site offering affordable, statistically reliable and valid  career and personality assessments for individuals and organizations. All assessments are available online with several personalized reports to choose from.  Prices include the cost of the assessment, resulting report and telephone counseling session.  Self-assessments without career counseling are also available. Additional professional services include Resume Writing and Outplacement Services for both individuals and corporate clients. 121

The Career Interests Game

Welcome to the Career Interests Game! This is a game designed to help you match your interests and skills with similar careers. It can help you begin thinking about how your personality will fit in with specific work environments and careers. Come play along and see what happens! For more information about the Career Interests Game, careers, majors, and self-assessments (the SDS, Discover, Choices and SIGI-PLUS), call or come by the Career Center. 122

The Career Key: Choosing a Career -- Career Guidance

The Career Key will help you in choosing a career, a college major; changing a career; and career planning. Thousands visit daily for free professional career help. Choose You , Us, Others to begin:
123

Korn/Ferry International

Futurestep, a Korn/Ferry International company, is a global leader in middle management recruitment. Drawing from Korn/Ferry’s more than 30 years of industry experience, Futurestep provides customized recruitment solutions to employers – and offers candidates access to exclusive job opportunities around the world.  124

GSIA: Career Opportunities Center

Overview

This material is essential reading for anyone beginning a job search, writing a resume, or planning to interview. Self-assessment is the cornerstone of career decision making! It will make your job search easier if you spend time on this chapter.

We suggest that you print out this form, find a quiet place or sit down with a friend and complete the following self-assessment exercise. This is one of the most important homework assignments you will complete at GSIA and one of the most difficult. The answers you select are not cast in concrete; they can and will change as you gather more information. To get where you are going, you have to know where you are and where you have been.

Review your answers to the value and skills exercises from orientation. Throughout your career your values and the skills you want to use will change, so reviewing them on a yearly basis is a good exercise. Career Discovery is another tool you can use to learn more about yourself.

  1. Describe yourself in one sentence:
  2. What are your greatest:
    • Abilities:
    • Skills:
    • Interests:
  3. What abilities, skills and interests do you want to cultivate?
  4. What really makes you who you are?
  5. What do you consider your major accomplishments?
    • At work:
    • At school:
    • In your personal life:<
  6. What challenges you the most?
  7. Are you a creative person? Analytical? Mechanical?
  8. Do you prefer working independently or as part of a team?
  9. Do you need structure, or are you comfortable setting your own pace?
  10. How much variety do you need?
  11. How important is stability to you?
  12. Which of your abilities do people most often praise? Which habits are most often criticized?
  13. How have you set yourself apart from the crowd?
  14. How do you handle long hours? Heavy pressure? Deadlines?
  15. How do you get along with others? Are you a natural leader? A team player?
  16. Are you an overachiever?
  17. What kinds of new experiences and people would you like to encounter in the future?
  18. What kind of image do you think you project? Want to project?
  19. What do you currently know about the following career areas?
    • Finance
    • Marketing
    • Consulting
    • Banking
    • Operations/Production/Manufacturing
    • Information Systems
    • Strategic Planning
  20. What are the 10 most important things you are looking for in a job (can include things like: travel, challenge, stability, 40 hour work weeks, benefits, etc.)
125

Interest Finder Quiz

Work Interest Quiz126

The Highlands Program

In 1990 we pioneered a distinct methodology called The Whole Person Technology®. People who participate in the assessments, in workshops based on this approach, achieve a remarkably consistent result: they experience an exceptionally high degree of satisfaction, meaning, productivity and success in their work and in their lives.
127

Jackson Vocational Interest Survey

There are over 36,729 possible careers in North America today, and over 284 academic majors. A few will make you very happy. The rest may leave you feeling unsatisfied and trapped. How will you find the one that is best for you? Taking a career test can help. Take the JVIS, and you'll be on your way to peace of mind….and a bright, rewarding future.

Take the JVIS Now

The JVIS is an educational and career planning tool. It provides a detailed snapshot of your interests and how they relate to the world of study and work. It will focus your search for professional and academic satisfaction. You'll have access to links, resources, and industry contacts to help you learn more about the careers and university majors that will help you make the most of your time and talent.128

Utne.com: Test Your Emotional IQ

Special to Utne Reader, Nov/Dec '95
Daniel Goleman

You've got the intellectual credentials: You did pretty well in school, maybe have a college diploma or even an advanced degree. You got high scores on your SATs and GREs, or even on that holy grail of the intellect, the IQ test. You may even be in Mensa, the select high-IQ club.

That's fine when it comes to intelligence of the academic variety. But how bright are you outside the classroom, when it comes to life's stickier moments? There you need other kinds of resourcefulness -- most especially emotional intelligence, a different way of being smart. 129

OnlineProfiles

Instant Feedback with Onlineprofiles !
Welcome to the onlineprofiles.com Site. You will find here practical resources to
assist you in your work and in your career.
130

Emode.com: Career Tests

131

HumanMetrics - Internet online relationships, personality and entrepreneur tests, personal solution center

HUMANMETRICS TRY YOUR TRAITS BEFORE TRYING FATE132

Personality Test

Personality Test
Click on the shape you find most appealing. Consider both form and color.
133

Inner Self Personality Test

Inner Self Personality Test

Based on 60 Multiple Choice Questions134

Contacting a Career Professional

NBCC

 









RACCCCECounselorFindmyNBCCNBCC Insurance

© NBCC, 2001  
135

NCDA

NCDA Awards Nominations for 2003
Do you have a colleague who has gone to great lengths to provide career counseling to individuals in your state, who has developed innovative programs to enhance career development, who has influenced legislation, or who has been a leader in your state or in NCDA? Please nominate that person to receive an NCDA award! The awards will be presented at the NCDA Conference in Denver, Colorado.
136

CPAD Network

The Career Planning & Adult Development Network keeps you in touch with other career counselors, career coaches, job search trainers and human resource professionals through its publications, workshops and conferences. The NETWORK publishes a bimonthly newsletter and quarterly journal, both free to NETWORK members. The NETWORK also conducts certification workshops for job and career transition coaches
& job search trainers.
137

Career Masters Institute

WELCOME TO THE CAREER MASTERS INSTITUTE
Career & Employment Industry’s First Global Training, Development &
Professional Networking Organization
138

PRWRA

The PRWRA empowers its global members
to utilize innovative and proactive resources
in their complete career development, résumé writing, and employment practices.139

7. Education and Online Learning Sites

University of Phoenix - Adult Education, Evening Classes, Degree Programs, Online Education, Bachelor Degrees, Night School

At University of Phoenix, you can earn your bachelor’s, master’s or doctoral degree any way you want to – on campus, online, or in certain areas using a combination of both, which we call FlexNet®. University of Phoenix has grown to be the nation’s largest private university, specializing in the education of working adults by offering degree programs that are highly relevant, accessible, and efficient. With over 100 campuses and learning centers in the United States, Puerto Rico, Canada and via the Internet, you can complete your degree no matter where you live, what hours you work, or how often you travel or relocate. 140

Online Programs - UMUC
Online Programs
University of Maryland University College has pioneered the next wave in access to education: online delivery.

Online education at UMUC offers educational opportunities unparalleled by any other university. With more than 20 complete degree programs available online (and more added each semester), UMUC students around the world can complete their degree without having to set foot in a classroom.

Online programs at University of Maryland University College are very user friendly, allowing the student to interact directly with instructors and coursemates through WebTycho, the university's own online delivery software.

If you would like to see how distance education works, visit our Orientation to Distance Education. If you'd like to see how UMUC delivers its online programs via WebTycho, take the Online Test Drive.
141

American Military University - Earn a Graduate or Undergraduate Degree Online.

American Military University is an accredited private institution of higher learning. Our distance learning system supports more than 10,000 students from all 50 states and many foreign countries. AMU is licensed by the West Virginia Higher Education Policy Commission and, as a member institution of the American Public University System, is nationally accredited by the Distance Education and Training Council.

Through its innovative and convenient online learning method, AMU offers a wide variety of undergraduate and graduate-level degree and certificate programs to students. Affiliation with the military is not a requirement for admission and many civilian students enroll in AMU programs. However, AMU is dedicated to providing quality education to the men and women of the Armed Forces. Many academic programs are designed to advance the careers of military personnel serving in a variety of professions and assignments.

All of AMU's programs are delivered through state-of-the-art online distance learning with no residency requirements. AMU's world-class faculty of more than 400 scholars has decades of relevant work experience and the highest levels of academic credentials.

142

Peterson's Education Portal – Colleges, Graduate Programs, Financial Aid

Learn...Anytime, Anywhere
Interested in earning your degree online? Get recruited by distance learning providers searching for applicants like you.143

America's Learning eXchange

careeronestopcareeronestopAJBAJBservicelocatorservicelocatoracinetacinet144

America's Job Bank - job search engine - Jobs

Welcome to America's Job Bank!
Visit our site and see how we can help you find the job that's right for you. Thousands of new jobs are posted daily by employers searching for someone like you.
145

Distance Learning on the Net - By Glenn Hoyle

Distance Learning on the Net celebrates 8 years of bringing descriptions of distance education web sites, along with links to lead you to further Distance Learning and education resources. 146

Distance Learning Course Finder
Welcome to the Galaxy of Distance Learning!

The International Distance Learning Course Finder is the world's largest online directory of e-learning courses from 130 countries. This universal distance education resource has information on over 55,000 distance learning courses and programs offered from a multitude of universities, colleges and companies.147

MindEdge

Copyright © 2001 MindEdge, Inc., All rights reserved.
148

The Distance Education and Training Council

Copyright © 2002 Distance Education and Training Council — All rights reserved.
149

Bears Guide

Bears' Guide to Earning Degrees
by Distance Learning
14th Edition
by John Bear, Ph.D., and Mariah Bear, M.A.

After 25 years and over 350,000 copies sold, this classic bestseller is still the resource for anyone looking to earn a degree in a nontraditional way—whether by distance learning, evening courses, credit for life experience, or guided independent study. 

  • Detailed information on over 2500 schools
  • Covers associate's, bachelor's, master's, and doctoral degrees, as well as law and medical studies
  • Tips on how to obtain credit for life experiences
  • The leading resource on degree mills and how to avoid them
  • 150

    Welcome to Capella University

    Capella University offers over 500 online courses, as well as undergraduate and graduate degree programs in 40 areas of specialization - all as close as your computer.
    151

    Kaplan Higher Education

    Copyright © 2002 Kaplan Higher Education. All rights reserved.
    Kaplan is a registered trademark of Kaplan, Inc.

    152

    Study at home with Education Direct Technical, Business, Computer, Career

    Welcome to Education Direct
     
    The at-home learning choice for millions of students worldwide.  
    Education Direct will start you on
    the road to more money and job satisfaction. We offer proven, flexible distance learning programs so you
    can learn at your own pace in the convenience of your own home.
    Think of it - you'll gain exciting new skills without giving up your current
    job or attending any classes.
     
    153

    Microsoft eLearn | Home

    Welcome to Microsoft eLearn


    Here you will find the latest information about online content and resources available today from Microsoft and our eLearning vendors. By providing the enabling technology, content, and services in eLearning—our goal is to enable anytime, anywhere access to information for knowledge workers. Whether you are an educator, trainer, solution provider, global company, or just interested in what Microsoft is doing in the area of eLearning—we have something for you.154

    Traditional Education Programs

    My College Guide

    How does the ACT compare to the SAT?  Does it really matter which test is taken? Answer >


    Attention Colleges: Interested in being listed in My College Guide? Contact Cynthia Klenke by e-mail.
    More than 150 tons of meteorite debris slams into the Earth each year.
    155

    College search, financial aid, and scholarships: CollegeView

    college search, college admissions, admissions, college, scholarship search, scholarships, scholarship, financial aid, universities, university, college application, application, minority scholarship, minority, hobsons, campus tours

    college search

    scholarships

    financial aid

    universities

    university

    minority

    hobsons

    campus tours

    college searchscholarship searchcollege admissionscollegeuniversitiesuniversityscholarshipsfinancial aiduniversity applicationhobsonscampus toursminorityapplicationadmissions




    Media Center  |  Contact Us  |  Site Map  |  Privacy Statement  |  Help  |  Feedback












    156

    Career Explorer: Map Search for schools across the country






    Win money for school!
    Click here to enter the Career Explorer Scholarship Contest!
    AKIAHIHIHIHIHIHIHIHIPRPRPRPRCANMTNVCAORWAIDWYUTAZTXSDMIWIMIMNNDNECONMOKKSMOTNARMSLAFLALGASCILINKYNCVACTRIMAOHWVMDDENJPANYMDDENJCTRIMAVTNHVTNHME
    Career: Careers | Aptitude Test| Articles | Job Search Schools: Map Search| Courses | Articles Financial Aid: Scholarships | Articles | Links Resources: FAQ | Survey | Articles | Links Contact Us: Contact Info | Add your school | Advertise